Vreelandella aquamarina Althf1: HAALTHF_00170n Help Entry HAALTHF_00170n    CDS       T06639                                  Name (GenBank) hypothetical protein   KO K00014   shikimate dehydrogenase [EC:1.1.1.25] Organism haxi  Vreelandella aquamarina Althf1 Pathway haxi00400   Phenylalanine, tyrosine and tryptophan biosynthesis haxi00999   Biosynthesis of various plant secondary metabolites haxi01100   Metabolic pathways haxi01110   Biosynthesis of secondary metabolites haxi01230   Biosynthesis of amino acids Module haxi_M00022   Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate Brite KEGG Orthology (KO) [BR:haxi00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     HAALTHF_00170n   09110 Biosynthesis of other secondary metabolites    00999 Biosynthesis of various plant secondary metabolites     HAALTHF_00170n Enzymes [BR:haxi01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.25  shikimate dehydrogenase (NADP+)      HAALTHF_00170n BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Shikimate_dh_N Motif Other DBs NCBI-ProteinID:  BBI69960 LinkDB All DBs Position complement(10406..10684) Genome browser AA seq 92 aa AA seqDB search MTDRYCVFGNPIKHSKSPLIHGEFASQTHQAMSYTAELAPVEGFADAWRAFIADGGRGAN VTVPFKGDAFALCDTLSHRAKRAGGEYADCGR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgactgaccgctactgtgtgtttggtaacccaatcaaacactctaaatcgccgctgatc cacggtgagtttgccagccagactcatcaggccatgagttacaccgccgagctggcgccg gtagaggggtttgccgacgcatggcgggcgtttatcgccgatggtggccgtggtgccaac gtgaccgttcccttcaaaggcgatgcctttgcgctttgcgataccctgagccaccgcgcc aagcgcgcaggcggtgaatacgctgattgtgggcggtaa

DBGET integrated database retrieval system