Vreelandella aquamarina Althf1: HAALTHF_33100n Help Entry HAALTHF_33100n    CDS       T06639                                  Symbol acpP1 Name (GenBank) acyl carrier protein 1   KO K02078   acyl carrier protein Organism haxi  Vreelandella aquamarina Althf1 Pathway haxi01100   Metabolic pathways haxi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haxi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HAALTHF_33100n (acpP1)    00074 Mycolic acid biosynthesis     HAALTHF_33100n (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HAALTHF_33100n (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BBM05791 LinkDB All DBs Position 2164829..2165062 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaagaaagttgtggcagagcgcctgaacgttaaagaa gaagacatccagaatagctcttctttcactgaagacttgggtgccgactctctggacacc gttgaactggtgatggctttggaagaggagttcgatactgaaattcctgacgaagaagct gaaaaaatcaccacggttcaagaagccatcgactacgtaaacgcccaccagtaa

DBGET integrated database retrieval system