Vreelandella aquamarina Althf1: HAALTHF_41990n Help Entry HAALTHF_41990n    CDS       T06639                                  Name (GenBank) hypothetical protein   KO K00052   3-isopropylmalate dehydrogenase [EC:1.1.1.85] Organism haxi  Vreelandella aquamarina Althf1 Pathway haxi00290   Valine, leucine and isoleucine biosynthesis haxi00660   C5-Branched dibasic acid metabolism haxi01100   Metabolic pathways haxi01110   Biosynthesis of secondary metabolites haxi01210   2-Oxocarboxylic acid metabolism haxi01230   Biosynthesis of amino acids Module haxi_M00432   Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate Brite KEGG Orthology (KO) [BR:haxi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00660 C5-Branched dibasic acid metabolism     HAALTHF_41990n   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     HAALTHF_41990n Enzymes [BR:haxi01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.85  3-isopropylmalate dehydrogenase      HAALTHF_41990n BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Iso_dh KDM5_C-hel DUF166 Motif Other DBs NCBI-ProteinID:  BBM05976 LinkDB All DBs Position complement(2738905..2739120) Genome browser AA seq 71 aa AA seqDB search MAKEYPDVSIDRELVDAVTTRMVLKPETLDVVVATNLHADILSDLAAALSGSLGIAPTAN LNPERQFPLDV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtggccaaagagtatcccgatgtttccattgaccgtgagttggtggatgcggtgactacg cgcatggtgctgaaacctgaaacgcttgacgtggtggtagcgactaatttgcatgccgat attctctccgatttagccgctgcgctttcaggcagcttagggattgctcctacggcaaac ctcaatccagaacgtcagttccccctcgatgtttga

DBGET integrated database retrieval system