Vreelandella aquamarina Althf1: HAALTHF_43530n Help Entry HAALTHF_43530n    CDS       T06639                                  Name (GenBank) hypothetical protein   KO K08973   protoporphyrinogen IX oxidase [EC:1.3.99.-] Organism haxi  Vreelandella aquamarina Althf1 Pathway haxi00860   Porphyrin metabolism haxi01100   Metabolic pathways haxi01110   Biosynthesis of secondary metabolites haxi01240   Biosynthesis of cofactors Module haxi_M00121   Heme biosynthesis, plants and bacteria, glutamate => heme Brite KEGG Orthology (KO) [BR:haxi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     HAALTHF_43530n BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  UPF0093 CopD Motif Other DBs NCBI-ProteinID:  BBM06014 LinkDB All DBs Position complement(2840425..2840673) Genome browser AA seq 82 aa AA seqDB search MQALQLRKDAGFAQGTPPMPRFFYNSIATPAALAAIASGTLLFLLHGLLGGWLILKLGAV VLMVAAHGCFGWLILRLEKGDF NT seq 249 nt NT seq  +upstreamnt  +downstreamnt ttgcaagcgctgcagctacgtaaagacgctggcttcgcccagggcacaccgcccatgccg cggtttttctataattccatcgccaccccggcggcactcgcggcgattgcttcaggcacg ctgctatttctgttgcatggcctgttaggcggctggttgatcttaaagctgggggccgtg gtgttaatggtggccgctcacggctgctttggctggctcatcctgcgccttgagaagggg gatttttaa

DBGET integrated database retrieval system