Halorussus vallis: NGM07_10015 Help Entry NGM07_10015       CDS       T09372                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism haxy  Halorussus vallis Pathway haxy03010   Ribosome Brite KEGG Orthology (KO) [BR:haxy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NGM07_10015   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NGM07_10015  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:haxy03011]     NGM07_10015    04121 Ubiquitin system [BR:haxy04121]     NGM07_10015   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:haxy04147]     NGM07_10015 Ribosome [BR:haxy03011]  Ribosomal proteins   Eukaryotes    Small subunit     NGM07_10015   Archaea     NGM07_10015 Ubiquitin system [BR:haxy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NGM07_10015 Exosome [BR:haxy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NGM07_10015   Exosomal proteins of colorectal cancer cells    NGM07_10015 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPAB4 Cas12f1-like_TNB Ribosomal_L37e Baculo_ME53 HypA Motif Other DBs NCBI-ProteinID:  USZ77652 LinkDB All DBs Position 1974286..1974420 Genome browser AA seq 44 aa AA seqDB search MARNEYYNDDGTTDKETCTRCGDSFLADHDDRLHCGRCGYTEWK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaacgagtactacaacgacgacggcaccaccgacaaggaaacctgcacgcgc tgtggcgactcgttcctcgccgaccacgacgaccgcctccactgcggccgttgcggttac accgagtggaagtag

DBGET integrated database retrieval system