Halorussus vallis: NGM07_20695 Help Entry NGM07_20695       CDS       T09372                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism haxy  Halorussus vallis Pathway haxy03010   Ribosome Brite KEGG Orthology (KO) [BR:haxy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NGM07_20695   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NGM07_20695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:haxy03011]     NGM07_20695    04121 Ubiquitin system [BR:haxy04121]     NGM07_20695   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:haxy04147]     NGM07_20695 Ribosome [BR:haxy03011]  Ribosomal proteins   Eukaryotes    Small subunit     NGM07_20695   Archaea     NGM07_20695 Ubiquitin system [BR:haxy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NGM07_20695 Exosome [BR:haxy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NGM07_20695   Exosomal proteins of colorectal cancer cells    NGM07_20695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 DUF7310 Zn_ribbon_IS1595 Zn_ribbon_RPAB4 RPA_interact_C XhlA bZIP_1 BRI3 Motif Other DBs NCBI-ProteinID:  USZ78082 LinkDB All DBs Position unnamed1:complement(119363..119605) Genome browser AA seq 80 aa AA seqDB search MSRRRVIRNREERRESYLRELESRVDRLESEVAWLRRAVQIDGERNDHLVMGPCPRCAVG VLARQNDRLECSDCGYSRFL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcagacggagggtaatccgaaaccgcgaggagcgccgcgagagctacctccgggaa ctggagtcgcgagtcgaccgcctggagtcggaggtggcgtggctccggcgggccgtccag atcgacggcgagcggaacgaccacctcgtgatggggccgtgtccgaggtgcgcggtgggc gtgctcgcccggcagaacgatagactcgagtgcagcgactgcggttacagtcgcttcctg tag

DBGET integrated database retrieval system