Halorussus gelatinilyticus: M0R88_04365 Help Entry M0R88_04365       CDS       T08255                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism haxz  Halorussus gelatinilyticus Pathway haxz03010   Ribosome Brite KEGG Orthology (KO) [BR:haxz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     M0R88_04365   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     M0R88_04365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:haxz03011]     M0R88_04365    04121 Ubiquitin system [BR:haxz04121]     M0R88_04365   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:haxz04147]     M0R88_04365 Ribosome [BR:haxz03011]  Ribosomal proteins   Eukaryotes    Small subunit     M0R88_04365   Archaea     M0R88_04365 Ubiquitin system [BR:haxz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    M0R88_04365 Exosome [BR:haxz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    M0R88_04365   Exosomal proteins of colorectal cancer cells    M0R88_04365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPAB4 zf-C2H2_ZN142 HypA Motif Other DBs NCBI-ProteinID:  UPW01342 UniProt:  A0A8U0ILW0 LinkDB All DBs Position 837077..837211 Genome browser AA seq 44 aa AA seqDB search MARNEYYNDDGTTDKEQCTRCGDAFLADHDDRLHCGRCGYTEWK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacgaaacgagtactacaacgacgacggcacgaccgacaaagaacagtgtacccgg tgtggcgacgcgttcctcgccgaccacgacgaccgcctccactgcggtcgctgtgggtat accgagtggaagtag

DBGET integrated database retrieval system