Halorussus gelatinilyticus: M0R88_05205 Help Entry M0R88_05205       CDS       T08255                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism haxz  Halorussus gelatinilyticus Pathway haxz03010   Ribosome Brite KEGG Orthology (KO) [BR:haxz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     M0R88_05205   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     M0R88_05205  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:haxz03011]     M0R88_05205    04121 Ubiquitin system [BR:haxz04121]     M0R88_05205 Ribosome [BR:haxz03011]  Ribosomal proteins   Eukaryotes    Large subunit     M0R88_05205   Archaea     M0R88_05205 Ubiquitin system [BR:haxz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    M0R88_05205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR zf-CHY Zn_Ribbon_1 Ribosomal_L37e DZR_2 Motif Other DBs NCBI-ProteinID:  UPW01503 UniProt:  A0A8U0IK86 LinkDB All DBs Position 1006211..1006360 Genome browser AA seq 49 aa AA seqDB search MASFEKAEARILDKMICMRCNARNPHGAENCRKCGYGNLRPKSKEPRNA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccagtttcgagaaagcggaagcgcgaatcctcgacaagatgatctgcatgcgatgt aacgctcgcaacccccacggagccgagaactgccgtaagtgcggctacggcaatctccga ccgaagagcaaggaaccgcgcaacgcctga

DBGET integrated database retrieval system