Haemophilus sp. oral taxon 036: C3V42_06585 Help Entry C3V42_06585       CDS       T05707                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hay  Haemophilus sp. oral taxon 036 Pathway hay01100   Metabolic pathways hay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C3V42_06585    00074 Mycolic acid biosynthesis     C3V42_06585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C3V42_06585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  AVM60295 LinkDB All DBs Position 1350776..1351006 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKSEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtattgaagaacgcgtgaaaaaaatcatcgttgaacaattaggtgttaaagaagaa gatgttaaatctgaagcttctttcgttgaagatttaggtgcggactctttagacacagtt gaattagtaatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaatcacaactgttcaatctgcgattgactacgtgcaaaacaatcaataa

DBGET integrated database retrieval system