Halorussus salilacus: NGM10_10545 Help Entry NGM10_10545       CDS       T09338                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hayc  Halorussus salilacus Pathway hayc03010   Ribosome Brite KEGG Orthology (KO) [BR:hayc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NGM10_10545   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NGM10_10545  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hayc03011]     NGM10_10545    04121 Ubiquitin system [BR:hayc04121]     NGM10_10545   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hayc04147]     NGM10_10545 Ribosome [BR:hayc03011]  Ribosomal proteins   Eukaryotes    Small subunit     NGM10_10545   Archaea     NGM10_10545 Ubiquitin system [BR:hayc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NGM10_10545 Exosome [BR:hayc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NGM10_10545   Exosomal proteins of colorectal cancer cells    NGM10_10545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPAB4 Cas12f1-like_TNB zf-C2H2_ZN142 Motif Other DBs NCBI-ProteinID:  USZ67169 LinkDB All DBs Position 2048579..2048713 Genome browser AA seq 44 aa AA seqDB search MARYELYDEDGTTDNEQCTRCGDSFLADHGDRLHCGRCGYTEWK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgatacgaactctacgacgaggacggcaccaccgacaatgagcagtgcacccgg tgtggcgactcgttcctcgccgaccacggcgaccgcctccactgcgggcgctgtggctac accgagtggaagtag

DBGET integrated database retrieval system