Halothiobacillus diazotrophicus: A9404_04230 Help Entry A9404_04230       CDS       T04441                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism haz  Halothiobacillus diazotrophicus Pathway haz01100   Metabolic pathways haz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9404_04230    00074 Mycolic acid biosynthesis     A9404_04230   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9404_04230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  ANJ66692 UniProt:  A0A191ZFR2 LinkDB All DBs Position 948689..948925 Genome browser AA seq 78 aa AA seqDB search MNDIEERLYALLIQEIPVSREGLTRDTTLEEIGLDSLATIEFMFQIEDQLGIRFDQTGTP PKTLGDVFDEVHAKLAEA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaacgatatcgaagaacgactctatgccctgctgatccaggagattcccgtctcgcgg gaaggactgacccgggacaccaccctcgaggaaatcggcctggattccctggcgaccatc gagttcatgttccagatcgaggatcagctcggcatccgcttcgatcagaccggcacgcca cccaagaccctgggcgacgtcttcgacgaagtgcacgccaagctggctgaggcctga

DBGET integrated database retrieval system