Halothiobacillus diazotrophicus: A9404_05630 Help Entry A9404_05630       CDS       T04441                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism haz  Halothiobacillus diazotrophicus Pathway haz01100   Metabolic pathways haz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9404_05630    00074 Mycolic acid biosynthesis     A9404_05630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9404_05630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  ANJ66930 UniProt:  A0A191ZGE8 LinkDB All DBs Position complement(1267545..1267784) Genome browser AA seq 79 aa AA seqDB search MSTVEERVKKIVVEQLGVKEEEVTNEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQLAIDYINAHKDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgtcgaagagcgcgtgaagaagattgttgtcgagcagctgggtgtcaaggaa gaggaagtgaccaacgaggcttctttcgttgacgatctgggtgcggattcactggatacg gtggaactggtaatggctttggaagaggaattcgagtgcgaaattcccgacgaagaagcc gagaagatcacgaccgtccaattggccattgattacatcaacgcccacaaagacgcataa

DBGET integrated database retrieval system