Halomicrobium sp. ZPS1: GBQ70_09030 Help Entry GBQ70_09030       CDS       T07700                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hazp  Halomicrobium sp. ZPS1 Pathway hazp03010   Ribosome Brite KEGG Orthology (KO) [BR:hazp00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     GBQ70_09030   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GBQ70_09030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hazp03011]     GBQ70_09030    04121 Ubiquitin system [BR:hazp04121]     GBQ70_09030   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hazp04147]     GBQ70_09030 Ribosome [BR:hazp03011]  Ribosomal proteins   Eukaryotes    Small subunit     GBQ70_09030   Archaea     GBQ70_09030 Ubiquitin system [BR:hazp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    GBQ70_09030 Exosome [BR:hazp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GBQ70_09030   Exosomal proteins of colorectal cancer cells    GBQ70_09030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 Ribosomal_L37e DUF7479 Zn_ribbon_3 DZR_2 zf-C2H2_FBX41 Cas12f1-like_TNB Zn_Ribbon_TF DZR zf-C2H2_ZN142 HypA DUF5817 Zn-ribbon_GIR1 Motif Other DBs NCBI-ProteinID:  QFR20573 LinkDB All DBs Position 1758464..1758598 Genome browser AA seq 44 aa AA seqDB search MARHEYYSDDGQIEREQCPRCGDTFLAEHDDRKHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgtcacgagtactacagcgacgacggtcagatcgaacgcgagcagtgcccccgg tgtggcgacaccttcctcgccgagcacgacgaccgcaaacactgcggcaagtgcggctac accgagtgggagtaa

DBGET integrated database retrieval system