Halomicrobium sp. ZPS1: GBQ70_12310 Help Entry GBQ70_12310       CDS       T07700                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism hazp  Halomicrobium sp. ZPS1 Pathway hazp03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:hazp00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     GBQ70_12310  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:hazp03009]     GBQ70_12310    03016 Transfer RNA biogenesis [BR:hazp03016]     GBQ70_12310    03029 Mitochondrial biogenesis [BR:hazp03029]     GBQ70_12310 Enzymes [BR:hazp01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      GBQ70_12310 Ribosome biogenesis [BR:hazp03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      GBQ70_12310 Transfer RNA biogenesis [BR:hazp03016]  Eukaryotic type   5'processing factors    Ribonucrease P     GBQ70_12310 Mitochondrial biogenesis [BR:hazp03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     GBQ70_12310 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 DUF4853 Motif Other DBs NCBI-ProteinID:  QFR21192 LinkDB All DBs Position 2395770..2396075 Genome browser AA seq 101 aa AA seqDB search MMPLTPETLPRHELAGLDVEVVAAANPDAIGIAGTVVTETTKTLGVEGTDRVWHVPKDAA TFRFDLPAEGDSESRSVRVRGSNLVARPARRTEATGDSKWR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgatgccactgacacccgaaacgctcccacgacacgaactcgccggcctcgacgtcgag gtcgtcgcagcggcaaatcccgacgcgatcggtatcgccgggaccgtcgtcaccgagacg acgaagacgctgggtgtcgaggggaccgatcgggtgtggcacgtgccgaaggacgcggcg acgttccggttcgacctcccggccgagggcgactccgagtcgcgctcggtccgggttcgc ggttcgaacctggtcgcccgccccgctcgacgcacggaagcgacaggtgattccaaatgg cgctag

DBGET integrated database retrieval system