Halomicrobium sp. ZPS1: GBQ70_14885 Help Entry GBQ70_14885       CDS       T07700                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism hazp  Halomicrobium sp. ZPS1 Pathway hazp00400   Phenylalanine, tyrosine and tryptophan biosynthesis hazp01100   Metabolic pathways hazp01110   Biosynthesis of secondary metabolites hazp01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:hazp00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     GBQ70_14885 Enzymes [BR:hazp01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      GBQ70_14885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 ATG1-like_MIT1 Motif Other DBs NCBI-ProteinID:  QFR21675 UniProt:  A0A5P8M050 LinkDB All DBs Position 2906607..2906894 Genome browser AA seq 95 aa AA seqDB search MSTNPEDMSLDELRTEIQTIDREIVEKIAQRTYVADTIAEVKDEKGLPTTDEDQEQSVMD RAGENAERFDVDANLVKAIFRLLIELNKVEQRESR NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaatccagaggacatgagtctcgacgaactgcgcacagagatccagacgatc gaccgcgagatcgtcgagaagatcgcacagcggacctacgtcgccgacacgatcgccgag gtcaaagacgagaagggcctgcccacgacggacgaagaccaggaacagtccgtgatggac cgggccggcgagaacgccgagcggttcgacgtggacgccaacctcgtgaaagcgatcttc cggttgctgatcgaactgaacaaagtggagcagcgggagagtcggtag

DBGET integrated database retrieval system