Hyalella azteca: 108665186 Help Entry 108665186         CDS       T07535                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism hazt  Hyalella azteca Pathway hazt04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:hazt00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     108665186  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hazt01009]     108665186   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hazt04131]     108665186    03036 Chromosome and associated proteins [BR:hazt03036]     108665186   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hazt04147]     108665186 Protein phosphatases and associated proteins [BR:hazt01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108665186 Membrane trafficking [BR:hazt04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108665186 Chromosome and associated proteins [BR:hazt03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108665186 Exosome [BR:hazt04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108665186 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF_EFCAB10_C EH EFhand_Ca_insen SPARC_Ca_bdg UPF0154 FCaBP_EF-hand Caleosin Poly_export SPEF2_C PhageMin_Tail Dockerin_1 Latarcin TerB MecA_N PA_Ig-like Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  108665186 NCBI-ProteinID:  XP_018007406 UniProt:  A0A8B7N0Q2 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MEADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRSF NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggaggctgaccaactcaccgaagaacagattgccgaattcaaggaagcgttctcactg ttcgacaaggatggtgatggtaccatcaccaccaaggagctgggcactgtcatgaggtcg cttggtcagaaccccacagaggccgagctccaggacatgatcaacgaagtcgacgctgat ggcaacggaacgatcgacttccccgaattcctgacgatgatggcgcgtaagatgaaggac accgacagtgaagaggagatccgagaagccttcagggtcttcgataaggacggcaacggc ttcatttccgccgctgagctaaggagcttttga

DBGET integrated database retrieval system