KEGG   Hyalella azteca: 108675676
Entry
108675676         CDS       T07535                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
hazt  Hyalella azteca
Pathway
hazt00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:hazt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108675676
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hazt00199]
    108675676
Enzymes [BR:hazt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108675676
Cytochrome P450 [BR:hazt00199]
 Cytochrome P450, animal type
  CYP306 family
   108675676
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 108675676
NCBI-ProteinID: XP_018019193
UniProt: A0A6A0GXB0
LinkDB
Position
Unknown
AA seq 613 aa
MWSWEAAAVAAAGGAAVAVVLLILNRNYHRKPSPPGPWGWPVIGSLLLLDPKQPHESLRS
LVRRYGPVVQLQLGEVRAVVLAREDLIRTTFAKEAASGRAPLYLTHGIMEGMGLVCAEGE
LWRDQRRFTVSVMRALGMRSGAARAALRMRILQTAQETAVNLGNGDEVSIRDPSSELLHS
LGNTMNLLVFGTCYDRHDPEWARLLYLLDEGSKLIGVAGPLNFLPWLRFLPQHRRTLKFI
KENQIKSHAIYQRIIDKFVAEKALQTEEDAKEVRHFVDAYMQEVWSRGAGMEGSFTPRQL
HHLAADLFGAGTETTVTSLRWLLLDLAAHQHYQERIFSEISALASEGYVQFSDIPKLLLT
QAALQESQRLHPVVTLGVPHGTTQDLEIAGYHVPKGTMLIPLLAEVHKDEVHWTNPEQFL
PERFIDHNEMQIIRHAAFMPFQTGRRVCPGEDFARLVLVLYVTQILLRYRLVLPKDYYNN
SYPAKSGNPKACGSTKGAGETTPSSLLQEGHGDRFETNSEKNELCRKPNPLAASLGDATS
DDDVDGNEGKYEHVSPRQEPQNDNKYSGQDELHECWDDDPFLNPVSGFTTSPRPYKLVFM
PRKHNTFIKPQFF
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgtggagttgggaggctgcggctgtggcggcagcaggtggcgcggcggtggccgtcgtc
ctcctgatcctcaacaggaactaccatcgcaaaccatcgccccccggcccatggggctgg
cctgtcatcggatcactgctgctgctcgaccccaaacagcctcatgagagccttcggtcg
ctggtgcgtcggtacggtccggtggtgcagctgcagctgggcgaggtgcgtgctgtggtg
ctcgcgagggaggaccttatacgcaccaccttcgccaaggaggccgcgtcaggccgagca
ccgctgtacctcacacacggcatcatggagggcatggggctcgtatgcgcagagggggag
ctatggcgcgaccagcggcgcttcacggtgtccgtgatgcgggcgctgggcatgcgcagc
ggcgcggcgcgggctgctctgcgcatgcgcatactccagaccgcccaagagactgccgta
aatctcggtaacggagacgaggtgagcatcagggaccccagttcagagctgctgcacagt
ctgggcaacaccatgaacctgctggtgttcgggacatgctacgacaggcacgacccggag
tgggcccgtctgctctacctcctcgatgagggcagcaagcttatcggagtcgcggggcct
ctcaacttcttaccctggctcagatttttgccgcaacaccgccggactcttaagttcatc
aaggagaaccagatcaagtcccatgcaatctaccaaagaatcatcgacaaattcgtcgcg
gagaaggcgctacaaactgaagaagatgcgaaggaagttcggcacttcgttgacgcttac
atgcaggaggtgtggtcgcgtggtgcaggcatggaggggagcttcaccccccgccagctt
catcacctcgctgctgatctcttcggcgcaggcacggagaccaccgtcacctccctgcgc
tggctgctgctcgacctcgctgctcaccagcactaccaggagagaatatttagtgagata
tcagcactggcttcagaaggatacgttcagttctcggacatcccgaagctccttctgacg
caggcggcgctgcaggagagccagcggctgcatcctgtcgtcacgctcggcgtcccgcac
ggcaccacgcaagacctggagatcgcaggataccacgtgcctaaaggaactatgctcatc
ccgctgctggctgaggtacataaggacgaggtgcattggacgaaccctgagcagttcctg
ccagaaagattcatcgaccacaacgagatgcagatcatcaggcacgccgccttcatgccc
ttccaaaccggtcgccgtgtgtgtcccggcgaagatttcgctcgtcttgtcctggtgctg
tacgtgacgcagatcttgttgcgctatcgcctcgtgcttcctaaagattattataataat
tcttatccagcaaaaagtggcaatccaaaagcttgcggctccacaaagggggctggagag
acgacgccatcttctttgcttcaagaaggacacggcgaccggttcgagaccaactccgaa
aaaaatgaactttgccggaaaccaaatcctctggcagcttcattaggagatgcgaccagc
gacgacgacgttgatggaaacgaaggcaagtatgaacatgtctctcctcgtcaagaacct
cagaacgacaataaatattcaggacaggatgaactgcatgaatgctgggacgacgatccg
tttctgaaccctgtcagtgggttcacaacctcccccaggccttacaaacttgtttttatg
ccaagaaaacataatacttttatcaaaccacaatttttttag

DBGET integrated database retrieval system