Hyalella azteca: 108679146 Help Entry 108679146         CDS       T07535                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism hazt  Hyalella azteca Pathway hazt03030   DNA replication hazt03082   ATP-dependent chromatin remodeling hazt03410   Base excision repair hazt03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hazt00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108679146    03410 Base excision repair     108679146    03420 Nucleotide excision repair     108679146   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108679146  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hazt03032]     108679146    03036 Chromosome and associated proteins [BR:hazt03036]     108679146    03400 DNA repair and recombination proteins [BR:hazt03400]     108679146 Enzymes [BR:hazt01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      108679146 DNA replication proteins [BR:hazt03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     108679146 Chromosome and associated proteins [BR:hazt03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     108679146 DNA repair and recombination proteins [BR:hazt03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       108679146 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone PAS DUF5937 DUF6080 Motif Other DBs NCBI-GeneID:  108679146 NCBI-ProteinID:  XP_018023217 UniProt:  A0A8B7PC07 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MAERPEDLNLPNSIVMRLIKDSLPPGVLVSKEARSAIARAASVFVLYATSTANALAQANK KKTLTGQDVLDAIKEMDFEQFVEPLTECLEAFKRSQQSKKELKEAKAKAKKQERSPAKKG APAEEQAAEEELGEDVVDVQE NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggctgagcgccctgaagacctgaacttgccgaactcaattgtgatgcgcctcattaaa gactccctgccacctggcgtgttggtgtccaaggaggcccgcagcgccatcgcgagagct gcctcggtgtttgtgctgtatgcgacgtcgacggccaacgccctggcgcaggccaacaag aagaagaccctcacggggcaggacgtcctcgacgccatcaaggagatggacttcgagcag ttcgtcgagcctctcaccgagtgccttgaagcgttcaagaggagccagcaaagcaagaag gagctgaaggaggcgaaggcgaaggccaagaagcaggagcgcagccccgccaagaagggg gcgccggcggaggagcaggcagctgaggaggagctgggggaggacgttgttgatgttcag gagtga

DBGET integrated database retrieval system