Hyalella azteca: 38169117 Help Entry 38169117          CDS       T07535                                  Symbol ND4L, D9L79_mgp03 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism hazt  Hyalella azteca Pathway hazt00190   Oxidative phosphorylation hazt01100   Metabolic pathways Module hazt_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:hazt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     38169117 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hazt03029]     38169117 (ND4L) Enzymes [BR:hazt01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      38169117 (ND4L) Mitochondrial biogenesis [BR:hazt03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     38169117 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Ferritin DUF5562 Motif Other DBs NCBI-GeneID:  38169117 NCBI-ProteinID:  YP_009515513 UniProt:  A0A385UM83 LinkDB All DBs Position MT AA seq 92 aa AA seqDB search MIMLALIVTLSACAFVSNYSHLLNSLLTLELLSVTLYLSIAAIFSSVGSELFYLLFFLVL VVCEGVLGISLLISLAHSHGEDYFKSMNAMQC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt attattatactggcgctcattgtaactttaagtgcttgtgcttttgtttcgaactacagc catttgttaaatagcttattaacgctagagctactttctgttacgctgtatttatctatt gcagcaatttttaggtctgtaggaagggagcttttttatcttctattttttctagtgcta gtagtgtgcgagggggtactaggcatctctcttctaatttccctcgcacatagccatgga gaagactactttaagtcgataaacgccatacaatgttaa

DBGET integrated database retrieval system