Hirschia baltica: Hbal_1311 Help Entry Hbal_1311         CDS       T00945                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism hba  Hirschia baltica Pathway hba01100   Metabolic pathways hba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hbal_1311    00074 Mycolic acid biosynthesis     Hbal_1311   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hbal_1311 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  ACT59003 UniProt:  C6XIQ8 LinkDB All DBs Position 1374401..1374646 Genome browser AA seq 81 aa AA seqDB search MTKDEAYAEISKNLIEIFEISEAEIKPEAKLMDDLGLDSIDAVDMMVQLQETTGQKVSPE QFENVVTVDDLVGLVIELTEK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgactaaagatgaagcctacgctgaaattagcaaaaacctgattgagatttttgaaatt tctgaagctgaaatcaaacctgaagctaagctgatggatgaccttggtttggatagtatt gatgcagttgatatgatggttcaacttcaagaaacgacgggtcagaaagtttcacctgag cagtttgaaaatgttgttactgttgatgatcttgttggtctcgtcatcgaacttacagaa aaatag

DBGET integrated database retrieval system