Hyphomonadaceae bacterium UKL13-1: AEM38_09670 Help Entry AEM38_09670       CDS       T04338                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism hbc  Hyphomonadaceae bacterium UKL13-1 Pathway hbc03060   Protein export hbc03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:hbc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AEM38_09670  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AEM38_09670  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:hbc02044]     AEM38_09670 Secretion system [BR:hbc02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AEM38_09670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AMS29660 UniProt:  A0A7U4QU00 LinkDB All DBs Position complement(2071069..2071299) Genome browser AA seq 76 aa AA seqDB search MGGMSLMHWLVVAAVALLVFGGRGKLSSIMKDAAEGIKGFRKGLADEPTAAASEAAKVND SNTIDVSPSAKSKTEA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggcggtatgagtctgatgcactggttggtcgttgcagccgtagcattgctggtgttc ggtggacgcggtaaactgtcctccatcatgaaagacgccgcagagggcatcaaaggcttc cgcaagggcttggccgatgaacccaccgctgcggcttctgaagcagccaaagtcaatgat agcaatacgattgacgtgagcccttcggctaagtctaagaccgaagcgtaa

DBGET integrated database retrieval system