KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_14060
Entry
AEM38_14060       CDS       T04338                                 
Name
(GenBank) LysR family transcriptional regulator
  KO
K04761  LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hbc03000]
    AEM38_14060
Transcription factors [BR:hbc03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    AEM38_14060
SSDB
Motif
Pfam: LysR_substrate HTH_1 MarR_2
Other DBs
NCBI-ProteinID: AMS30308
LinkDB
Position
complement(3024409..3025293)
AA seq 294 aa
MSQPTLRQLSFLTAIAEHGSFVAAAEQALVTQPSLSAAIKELEAILGTKLIERGRSGATL
TPAGEIAAARARAILSAVDELGEAVQGAAEPLTGPFRLGVIPTIAPFFLPKVLPRAKAAF
PKLKLYLREDLTSRLIDGLRAHTLDAALIALPYEAQGIDTMPLFDDEFLFVGPPDHPLSK
KADLSAADLEGEPVLLLEDGHCLRDHAIGVCGMTRPGQEEVRATSLFTLVQMAAGGLGIS
LLPKIAADAGIAADGLVVRAFTPPVIGRQIGLAWRRSSGRLIEIKALSGILKSA
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtctcagcccactttgcgtcaattatcctttttgacggcgattgccgagcatggctcg
tttgtcgccgctgctgaacaagccctcgttactcaaccgtcactgtctgcggcgatcaaa
gagctggaagccattctgggcacaaagctgattgagcgcggccggagtggggcgacgcta
acaccagctggcgagattgccgccgcccgcgcccgcgccatcctgtcagcagtcgatgaa
ttgggggaggcggtacagggtgctgcagaacctttgactgggccattccgtttgggtgtc
atcccaacgattgcgcccttctttttgcctaaggtcctgccgcgcgcaaaagcggctttc
cccaaactcaaactctatttgcgtgaggatttaaccagtcgattgatcgatggacttcgc
gcgcataccctagatgcagcattgattgcattgccttatgaagcccaaggcatcgacacc
atgcctttgtttgacgatgagtttttgttcgttggcccaccagaccatccgctttccaag
aaggctgacttgtcggcagcagacttggaaggcgagcccgttttattgttggaagatggt
cattgtctgcgcgatcacgcgattggcgtatgtggcatgacgcggcccggccaagaagag
gttcgagcgacatcattgtttaccttggtgcaaatggccgctgggggactcggcatttcg
ttgttgcccaagatcgctgccgatgctggcattgccgccgacggactcgtggtgcgcgcc
tttaccccaccggtgatcggacgacaaattggtcttgcctggcggcgcagctccggacgc
ttgattgaaatcaaggcgctttcggggatattgaaatcggcatga

DBGET integrated database retrieval system