Halomonas beimenensis: BEI_1249 Help Entry BEI_1249          CDS       T05125                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hbe  Halomonas beimenensis Pathway hbe01100   Metabolic pathways hbe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hbe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BEI_1249 (acpP)    00074 Mycolic acid biosynthesis     BEI_1249 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BEI_1249 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  ATJ82236 UniProt:  A0A291P5S3 LinkDB All DBs Position 1315063..1315296 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNTHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaacgtcaaggaa gaggacatccagaactcttcttctttcaccgaggacctcggcgcggattccctggatacc gtcgagctggtgatggcgctcgaagaggaattcgacaccgagattcctgacgaggaagcc gagaagatcaccaccgttcaggaagccatcgactacgtcaacacccaccagtaa

DBGET integrated database retrieval system