Halomonas binhaiensis: E4T21_04105 Help Entry E4T21_04105       CDS       T08791                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism hbh  Halomonas binhaiensis Brite KEGG Orthology (KO) [BR:hbh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hbh03036]     E4T21_04105 (ftsB) Chromosome and associated proteins [BR:hbh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     E4T21_04105 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC bZIP_1 ZapB bZIP_2 ADIP Motif Other DBs NCBI-ProteinID:  QEM80826 UniProt:  A0A5C1NBU2 LinkDB All DBs Position 946387..946686 Genome browser AA seq 99 aa AA seqDB search MLKRLAIVLLALLALLQYRLWLGQGGVQEMQEITARVAALEEANKPLRDRNARLAAEVVD LKTGLDAIEERARSDVGMVRTDEQFLWVPDTESARSGGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctcaagaggttggcgattgtgctgttggcactgcttgccctgctgcagtatcgactg tggctggggcagggtggtgtccaggaaatgcaggaaattactgcgcgcgttgcggcgctg gaggaggccaacaagcctctgcgtgatcgtaatgcgcgcttggcggcggaggtcgtcgat ctcaagaccggccttgatgccatagaggagcgtgcacgcagcgatgtgggcatggtgcgc actgacgagcaatttctgtgggtaccggatactgagtccgcgcggagcggtggtaaatga

DBGET integrated database retrieval system