Helicobacter bizzozeronii: HBZC1_13920 Help Entry HBZC1_13920       CDS       T01540                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hbi  Helicobacter bizzozeronii Pathway hbi01100   Metabolic pathways hbi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hbi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HBZC1_13920    00074 Mycolic acid biosynthesis     HBZC1_13920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HBZC1_13920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ribosomal_L12_N EFP Guanylate_cyc CCDC22_N Motif Other DBs NCBI-ProteinID:  CCB80378 UniProt:  F8KU39 LinkDB All DBs Position complement(1293433..1293669) Genome browser AA seq 78 aa AA seqDB search MALFEDVQAVIVEQLNVSATQVTEEADFIKDLNADSLDVVELIMALEEKFGIEIPDEQAE KIKTVGDAVRFIQDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcattatttgaggatgtgcaagcggtgattgttgagcagttgaatgtgagcgcgaca caggttacagaagaggcggattttatcaaggatctcaacgccgattcgttggatgtggtg gagcttatcatggctcttgaggagaagtttgggatcgagattcctgatgaacaagcagag aaaattaaaaccgtgggggatgcggttcgtttcattcaagacaataaattagcctag

DBGET integrated database retrieval system