Halogeometricum borinquense: Hbor_11060 Help Entry Hbor_11060        CDS       T01359                                  Name (GenBank) hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hbo  Halogeometricum borinquense Pathway hbo00280   Valine, leucine and isoleucine degradation hbo00630   Glyoxylate and dicarboxylate metabolism hbo00640   Propanoate metabolism hbo01100   Metabolic pathways hbo01110   Biosynthesis of secondary metabolites hbo01120   Microbial metabolism in diverse environments hbo01200   Carbon metabolism Module hbo_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hbo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     Hbor_11060    00640 Propanoate metabolism     Hbor_11060   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     Hbor_11060 Enzymes [BR:hbo01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      Hbor_11060     6.4.1.3  propionyl-CoA carboxylase      Hbor_11060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF8022 GH94_b-supersand Motif Other DBs NCBI-ProteinID:  ADQ66696 UniProt:  E4NQK8 LinkDB All DBs Position 1027824..1028087 Genome browser AA seq 87 aa AA seqDB search MSRVDDVNLSIPTAADEDEAAAIAAAVAAHLRDQQVAAAAAEDETDSWDGERWSFAGRMR AVSGCAARIPDGAPRDGWAAAGRTDRF NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcgtggacgacgtgaacctctccatcccgacggcggccgacgaggacgaagcc gcggccatcgccgccgccgtcgccgcgcacctccgcgaccaacaggtcgccgcggccgct gcggaggatgagaccgactcgtgggacggcgaacgctggtcgtttgccggtcggatgcga gccgtatccggatgcgccgcgcgtattccagatggcgcgccgcgcgacggatgggctgct gccgggcgcacagaccggttctaa

DBGET integrated database retrieval system