Halomonas sp. TD01: HPTD01_2702 Help Entry HPTD01_2702       CDS       T08977                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism hbp  Halomonas sp. TD01 Pathway hbp01100   Metabolic pathways hbp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hbp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPTD01_2702    00074 Mycolic acid biosynthesis     HPTD01_2702   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPTD01_2702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  CAH1044224 UniProt:  A0AA35E3X1 LinkDB All DBs Position HaloTd01MainCirc:2931156..2931389 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgtgaagaaagttgtggcagagcgcctgaacgttaaagaa gaagacatccagaacagctcttcttttactgaagacctgggtgctgattctcttgacacc gttgagctggtgatggcacttgaagaggaatttgatactgaaattcctgacgaagaagcc gaaaaaatcaccacggttcaagaagctatcgactacgtaaacgcccatcagtaa

DBGET integrated database retrieval system