Halotia branconii: QI031_08590 Help Entry QI031_08590       CDS       T09011                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism hbq  Halotia branconii Pathway hbq02024   Quorum sensing hbq03018   RNA degradation Brite KEGG Orthology (KO) [BR:hbq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     QI031_08590  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     QI031_08590  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hbq03019]     QI031_08590    03036 Chromosome and associated proteins [BR:hbq03036]     QI031_08590 Messenger RNA biogenesis [BR:hbq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      QI031_08590 Chromosome and associated proteins [BR:hbq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     QI031_08590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Motif Other DBs NCBI-ProteinID:  WGV27529 UniProt:  A0AAJ6NVJ6 LinkDB All DBs Position complement(1949875..1950093) Genome browser AA seq 72 aa AA seqDB search MHTTEFDTTLPSIRQLQNLIKQAAVIEFKLVTGDLLTGKVAWQDPNCVCIVDENNQQSTI CKQAIAYFQPKS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcacacaactgaatttgatacgacgctacctagcatccggcaattgcaaaacctgatt aaacaagcagcagtgatagagttcaaactggtaacaggcgatctgctaacaggtaaggtt gcatggcaagatccaaattgcgtatgtattgtcgatgaaaataatcagcaatccacaatt tgtaaacaagcgatcgcctacttccagcctaagagttag

DBGET integrated database retrieval system