Halotia branconii: QI031_23085 Help Entry QI031_23085       CDS       T09011                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hbq  Halotia branconii Pathway hbq00998   Biosynthesis of various antibiotics hbq01100   Metabolic pathways hbq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hbq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QI031_23085 (acpP)    00074 Mycolic acid biosynthesis     QI031_23085 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QI031_23085 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF6137 Ribosomal_L50 DUF5783 HLH Motif Other DBs NCBI-ProteinID:  WGV24627 UniProt:  A0AAJ6P8H0 LinkDB All DBs Position 5274106..5274363 Genome browser AA seq 85 aa AA seqDB search MSQTETEIFAKVKKIVADQLSVEAETITPKSNFANDLGADSLDTVELVMALEEEFDIEIP DEAAEKITTVQEAVDYINNKVAASA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagccaaacagaaacagaaatttttgcaaaagtcaagaagatcgtcgccgatcaactc agtgttgaagctgaaacaatcacacctaaatccaattttgccaacgatctaggggcagat tccttagatactgttgaattagtcatggctttggaagaagaatttgatatcgaaattcct gatgaagccgccgaaaaaattacaacagttcaagaagccgtggattacatcaacaacaaa gttgctgcatccgcctaa

DBGET integrated database retrieval system