Halotia branconii: QI031_25690 Help Entry QI031_25690       CDS       T09011                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hbq  Halotia branconii Pathway hbq00998   Biosynthesis of various antibiotics hbq01100   Metabolic pathways hbq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hbq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QI031_25690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QI031_25690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WGV25111 LinkDB All DBs Position complement(5852417..5852668) Genome browser AA seq 83 aa AA seqDB search MKTIDLITEKTKNIVLNILPNINREDLTESSNLFSLGLDSVNAMTLVLKLQSNFGIRFAV NDINAENFQSIEMIVQLINAKQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaaaactattgatttaattacagaaaaaactaaaaatatagttttaaatatattgcca aatattaatagagaagatttaacagaatctagtaatctctttagcctgggtctagattct gttaatgctatgacactagttttaaaattacagagtaattttggtattagatttgcagtt aatgatattaatgcagaaaatttccaaagtatagaaatgattgtgcagttaataaatgcc aagcaaggctga

DBGET integrated database retrieval system