Hevea brasiliensis (rubber tree): 110631734 Help Entry 110631734         CDS       T05150                                  Name (RefSeq) calmodulin-like protein 8   KO K02183   calmodulin Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr04016   MAPK signaling pathway - plant hbr04070   Phosphatidylinositol signaling system hbr04075   Plant hormone signal transduction hbr04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:hbr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     110631734    04070 Phosphatidylinositol signaling system     110631734    04075 Plant hormone signal transduction     110631734  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     110631734  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hbr01009]     110631734   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110631734    03036 Chromosome and associated proteins [BR:hbr03036]     110631734   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbr04147]     110631734 Protein phosphatases and associated proteins [BR:hbr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110631734 Membrane trafficking [BR:hbr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110631734 Chromosome and associated proteins [BR:hbr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110631734 Exosome [BR:hbr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110631734 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 SPARC_Ca_bdg Dockerin_1 EH EF_EFCAB10_C PA_Ig-like DUF5580_M Fe_hyd_lg_C Sigma54_CBD MinC_N_1 Motif Other DBs NCBI-GeneID:  110631734 NCBI-ProteinID:  XP_021635369 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MADALTEDQIAEFREAFCLIDKDSDGFITMEELATIIQSLDGHPTKEEVGDMISEVDIDG NGTIDFQEFLNIMGRKMKENVAEELKEAFKVFDRNQDGYISANELRQVMINLGERLTEEE AEQMIREADLDGDGLVSYEEFARMMMAF NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagacgcgcttactgaagatcagattgcagagttccgcgaggccttttgcttgatt gacaaggactcagatggcttcattacgatggaagaacttgctaccattatacaatcgctg gatggacatcctaccaaagaagaagttggagacatgataagtgaagtcgatattgatgga aatggaacaatagattttcaggagttcttgaacattatgggacggaaaatgaaggaaaat gttgctgaggagctaaaagaagctttcaaagtatttgacagaaaccaggatggatatata tcagccaatgagctaaggcaagtgatgataaatttgggggagagattgactgaggaggag gctgaacagatgattagagaggctgatttggatggtgatggtttagttagttatgaggag tttgccaggatgatgatggccttctaa

DBGET integrated database retrieval system