Hevea brasiliensis (rubber tree): 110644640 Help Entry 110644640         CDS       T05150                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr04145   Phagosome hbr04148   Efferocytosis hbr04517   IgSF CAM signaling hbr04518   Integrin signaling hbr04620   Toll-like receptor signaling pathway hbr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hbr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110644640    04518 Integrin signaling     110644640  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110644640    04148 Efferocytosis     110644640  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110644640  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110644640  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110644640   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbr04147]     110644640    04031 GTP-binding proteins [BR:hbr04031]     110644640 Membrane trafficking [BR:hbr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110644640  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110644640   Macropinocytosis    Ras GTPases     110644640  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110644640 Exosome [BR:hbr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110644640   Exosomal proteins of other body fluids (saliva and urine)    110644640   Exosomal proteins of colorectal cancer cells    110644640   Exosomal proteins of bladder cancer cells    110644640 GTP-binding proteins [BR:hbr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110644640 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110644640 NCBI-ProteinID:  XP_021653218 UniProt:  T1RLR6 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDYPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP TKQKKKKRRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaaggtttatcaagtgcgtcaccgttggtgatggtgctgttggcaagact tgcatgcttatctcctacaccagtaacactttccctaccgattatgtgccgacagtgttt gacaatttcagtgcaaatgtggttgtggatgggagcacagtcaatctagggttgtgggat accgctggccaggaggattacaatagattaagacctttgagttatcgtggggcagatgtt ttcctgcttgctttctctctcattagcaaggccagttatgaaaatgttgcaaagaagtgg attcctgaattgaggcattatgcacctggagtaccaattattcttgttgggactaagctt gatctccgagatgataagcaattctttatagattaccctggtgcagtgcccattactaca gctcagggggaggaactgagaaagctaatcggggcgcctgtttatattgaatgtagttct aaaactcagcagaatgtgaaagccgtctttgatgcagccattaaagtggttctccagcca acaaaacagaagaagaaaaagagaagaaaggctcaaaaggcctgctccatattgtga

DBGET integrated database retrieval system