Hevea brasiliensis (rubber tree): 110644640 Help Entry 110644640         CDS       T05150                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr04145   Phagosome hbr04148   Efferocytosis hbr04620   Toll-like receptor signaling pathway hbr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hbr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110644640    04148 Efferocytosis     110644640  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110644640  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110644640  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110644640   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbr04147]     110644640    04031 GTP-binding proteins [BR:hbr04031]     110644640 Membrane trafficking [BR:hbr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110644640  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110644640   Macropinocytosis    Ras GTPases     110644640  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110644640 Exosome [BR:hbr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110644640   Exosomal proteins of other body fluids (saliva and urine)    110644640   Exosomal proteins of colorectal cancer cells    110644640   Exosomal proteins of bladder cancer cells    110644640 GTP-binding proteins [BR:hbr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110644640 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110644640 NCBI-ProteinID:  XP_021653218 UniProt:  T1RLR6 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDYPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP TKQKKKKRRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaaggtttatcaagtgcgtcaccgttggtgatggtgctgttggcaagact tgcatgcttatctcctacaccagtaacactttccctaccgattatgtgccgacagtgttt gacaatttcagtgcaaatgtggttgtggatgggagcacagtcaatctagggttgtgggat accgctggccaggaggattacaatagattaagacctttgagttatcgtggggcagatgtt ttcctgcttgctttctctctcattagcaaggccagttatgaaaatgttgcaaagaagtgg attcctgaattgaggcattatgcacctggagtaccaattattcttgttgggactaagctt gatctccgagatgataagcaattctttatagattaccctggtgcagtgcccattactaca gctcagggggaggaactgagaaagctaatcggggcgcctgtttatattgaatgtagttct aaaactcagcagaatgtgaaagccgtctttgatgcagccattaaagtggttctccagcca acaaaacagaagaagaaaaagagaagaaaggctcaaaaggcctgctccatattgtga

DBGET integrated database retrieval system