Hevea brasiliensis (rubber tree): 110653128 Help Entry 110653128         CDS       T05150                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr04144   Endocytosis hbr04145   Phagosome hbr04148   Efferocytosis Brite KEGG Orthology (KO) [BR:hbr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110653128    04145 Phagosome     110653128    04148 Efferocytosis     110653128  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110653128   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbr04147]     110653128    04031 GTP-binding proteins [BR:hbr04031]     110653128 Membrane trafficking [BR:hbr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     110653128 Exosome [BR:hbr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110653128   Exosomal proteins of other body fluids (saliva and urine)    110653128   Exosomal proteins of colorectal cancer cells    110653128   Exosomal proteins of bladder cancer cells    110653128 GTP-binding proteins [BR:hbr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     110653128 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras GTP_EFTU Motif Other DBs NCBI-GeneID:  110653128 NCBI-ProteinID:  XP_021664422 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKIDVDDGNSRMISEKKAKAWCASKGNI PYFETSAKEGFNVDAAFQCIAKNALKNEPEEEIYIPDTIDVAGGGRQQRYTGCEC NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaagtcatttgataatcttaataattggagagaagagtttctgattcaggctagtcct tctgaccctgaaaacttcccattcgttgtgttggggaacaagatagatgtcgatgatggc aatagtcggatgatttcagagaagaaagcgaaggcatggtgtgcttctaagggaaacata ccttacttcgagacttctgcaaaagaaggattcaatgtggatgctgctttccagtgcata gccaaaaatgcactaaagaatgaacctgaagaagaaatatacattcctgacacgatcgat gttgcgggtggagggcgacagcaaagatacacaggatgtgaatgttag

DBGET integrated database retrieval system