Hevea brasiliensis (rubber tree): 110655899 Help Entry 110655899         CDS       T05150                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr04145   Phagosome hbr04148   Efferocytosis hbr04517   IgSF CAM signaling hbr04518   Integrin signaling hbr04620   Toll-like receptor signaling pathway hbr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hbr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110655899    04518 Integrin signaling     110655899  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110655899    04148 Efferocytosis     110655899  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110655899  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110655899  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110655899   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbr04147]     110655899    04031 GTP-binding proteins [BR:hbr04031]     110655899 Membrane trafficking [BR:hbr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110655899  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110655899   Macropinocytosis    Ras GTPases     110655899  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110655899 Exosome [BR:hbr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110655899   Exosomal proteins of other body fluids (saliva and urine)    110655899   Exosomal proteins of colorectal cancer cells    110655899   Exosomal proteins of bladder cancer cells    110655899 GTP-binding proteins [BR:hbr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110655899 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Sua5_C Motif Other DBs NCBI-GeneID:  110655899 NCBI-ProteinID:  XP_021668083 UniProt:  T1RLY1 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPVILVGTKL DLREDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKRKKKKGQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccaggttcattaagtgcgtcaccgtcggcgatggcgctgtcggcaagact tgcatgcttatctcatacaccagcaacaccttccccacggactatgtgccaaccgttttt gacaatttcagtgcaaatgtggttgtggatgggagcacggtcaatttaggtttatgggat acagctggtcaggaggattacaatagattaagacctttgagctatcgaggggcagatgtc tttattcttgcattctctttaatcagcaaggccagctatgaaaatgttgccaaaaagtgg attccagaactgaggcattatgcacctggagttcctgtcattcttgttggaacaaaactt gatcttcgcgaggataagcagttcttcattgaccatccgggtgcagtgcctatcactact gcccaaggagaggaactgagaaaacttattggagctcctgcctatatagagtgtagctca aaaacacagcagaatgtgaaggcggtttttgatgcagcaatcaaggtggttctgcagccc cccaagcaaaagagaaagaagaaaaagggacaaaaggcttgctctatattgtga

DBGET integrated database retrieval system