Hevea brasiliensis (rubber tree): 110655911 Help Entry 110655911         CDS       T05150                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr03083   Polycomb repressive complex hbr04120   Ubiquitin mediated proteolysis hbr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hbr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110655911    04120 Ubiquitin mediated proteolysis     110655911   09126 Chromosome    03083 Polycomb repressive complex     110655911  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110655911    04121 Ubiquitin system [BR:hbr04121]     110655911    03036 Chromosome and associated proteins [BR:hbr03036]     110655911 Membrane trafficking [BR:hbr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110655911 Ubiquitin system [BR:hbr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110655911    Cul7 complex      110655911 Chromosome and associated proteins [BR:hbr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110655911   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110655911 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Methyltransf_16 Motif Other DBs NCBI-GeneID:  110655911 NCBI-ProteinID:  XP_021668106 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MSTGKKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC KKHVETSKSDDRPSSVDDELKAWDAEFVKVDQATLFDLILAANYLNIKSLLDHTCQTVAD MIKGKTPEEIRTTFNIRNDFTPEEEEEVRRENQWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcaacaggcaagaaaatcactttgaaaagctcagacggagagacctttgaggtggat gaggcggtggctctcgaatcgcagacgataaagcacatgatagaggacgattgcgcagat aacggtatccctctgcctaatgtcaccagcaaaattctctctaaggtaattgagtactgt aagaagcatgtcgagacgtccaagtctgatgatcgtccttcttctgttgatgacgagttg aaggcctgggacgctgagttcgtcaaagttgatcaggctactctcttcgatctcatcctg gctgccaactatctaaacatcaagagcttgctggatcacacttgtcagacagtggcagac atgatcaagggcaaaactccagaggaaattcgcacgactttcaacatcaggaatgacttt acacctgaggaagaggaggaagttcgcagagaaaaccaatgggcctttgagtga

DBGET integrated database retrieval system