Hevea brasiliensis (rubber tree): 110658756 Help Entry 110658756         CDS       T05150                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr03018   RNA degradation hbr03040   Spliceosome Brite KEGG Orthology (KO) [BR:hbr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     110658756   09123 Folding, sorting and degradation    03018 RNA degradation     110658756  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hbr03019]     110658756    03041 Spliceosome [BR:hbr03041]     110658756 Messenger RNA biogenesis [BR:hbr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      110658756   mRNA degradation factors    5'-3' decay     Lsm complex      110658756 Spliceosome [BR:hbr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     110658756  Complex C   U2 snRNP components     110658756 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  110658756 NCBI-ProteinID:  XP_021672182 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDIDLLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctgttcttttcgtatttcaaggacttggttggtagggaagtgacagtggagctgaag aacgatttggcaatcagaggaacgcttcactctgtcgatcagtacctcaatatcaagctc gagaacactagggttgtcgatcaagacaagtaccctcacatgctttctgtcaggaactgt tttataaggggatctgtggttagatatgttcagttgcctccagaaggtgttgacattgat ttgctccatgatgcaacaagaagagaagctcggggtggctga

DBGET integrated database retrieval system