Humisphaera borealis: IPV69_14095 Help Entry IPV69_14095       CDS       T07075                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism hbs  Humisphaera borealis Brite KEGG Orthology (KO) [BR:hbs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hbs03110]     IPV69_14095 (groES)    03029 Mitochondrial biogenesis [BR:hbs03029]     IPV69_14095 (groES) Chaperones and folding catalysts [BR:hbs03110]  Heat shock proteins   HSP10    IPV69_14095 (groES) Mitochondrial biogenesis [BR:hbs03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     IPV69_14095 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 MelC1 Motif Other DBs NCBI-ProteinID:  QOV87423 UniProt:  A0A7M2WPT1 LinkDB All DBs Position 3780304..3780597 Genome browser AA seq 97 aa AA seqDB search MALKLKPLADRVIVKQTEAEEKTASGIYLPDAAKEKPTKGKVIAAGPGKFDDNGKRMELA VSVGDTVYYGKYAGTDVEVDGQKLVILRESDILGVLE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcactcaagctcaagcccctggccgaccgtgtaatcgtcaagcagaccgaagccgaa gaaaagaccgccagcgggatttacctcccggacgcggccaaggaaaagcccaccaagggc aaggtcatcgccgccggccccggcaagtttgatgacaacggcaagcggatggaactggcc gtctcggtcggcgacaccgtctactacggcaagtacgccggcaccgatgtcgaagtcgac gggcagaagctcgtcatccttcgcgagtcggacatcctcggcgttctcgagtaa

DBGET integrated database retrieval system