Humisphaera borealis: IPV69_19130 Help Entry IPV69_19130       CDS       T07075                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hbs  Humisphaera borealis Pathway hbs01100   Metabolic pathways hbs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hbs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IPV69_19130 (acpP)    00074 Mycolic acid biosynthesis     IPV69_19130 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IPV69_19130 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 UBA_2 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QOV88345 UniProt:  A0A7M2WS31 LinkDB All DBs Position 5130622..5130864 Genome browser AA seq 80 aa AA seqDB search MEDIDQKVIEIVSEQMGVDKSEITRDTHFINDLNADSLDTVELVMEFEDEFELSIPDEEA EKIQTVGQAIDYIKGHQSKQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaagacatcgaccagaaggtcatcgaaatcgtcagcgaacagatgggcgtcgataag agcgagatcacgcgcgacacccatttcatcaacgacctcaacgccgactcgctcgacacc gtcgagctggtgatggagttcgaggacgagttcgagctgtcgatccccgacgaagaggcc gagaagatccagaccgtcggccaggcgatcgactacatcaagggccaccagagcaagcag taa

DBGET integrated database retrieval system