Hyperthermus butylicus: Hbut_0435 Help Entry Hbut_0435         CDS       T00468                                  Name (GenBank) 30S ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hbu  Hyperthermus butylicus Pathway hbu03010   Ribosome Brite KEGG Orthology (KO) [BR:hbu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Hbut_0435   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Hbut_0435  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hbu03011]     Hbut_0435    04121 Ubiquitin system [BR:hbu04121]     Hbut_0435   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbu04147]     Hbut_0435 Ribosome [BR:hbu03011]  Ribosomal proteins   Eukaryotes    Small subunit     Hbut_0435   Archaea     Hbut_0435 Ubiquitin system [BR:hbu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Hbut_0435 Exosome [BR:hbu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Hbut_0435   Exosomal proteins of colorectal cancer cells    Hbut_0435 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 DUF1451 Zn_ribbon_IS1595 NRDD Cas12f1-like_TNB Zn_ribbon_NUD Zn_ribbon_PriA DZR Zn_ribbon_recom Ribosomal_L37ae zf_UBZ EDR4-like_1st Gmx_para_CXXCG zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  ABM80301 UniProt:  A2BJZ0 LinkDB All DBs Position complement(422637..422825) Genome browser AA seq 62 aa AA seqDB search MSKELKLYVHRLYEYDYNTGTIKRKNKICPRCGSFMAFHKWPVPRWHCGKCGHTEFVREA KR NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaggagcttaagctctatgtgcacagactttacgagtacgactacaacactggc acaataaagaggaagaacaagatatgtccacgctgcggtagcttcatggcgttccacaag tggccggtgccgaggtggcattgtggtaagtgtggacacaccgagttcgttagggaagcc aagaggtga

DBGET integrated database retrieval system