Helicobacter pylori PeCan18: HPPC18_02680 Help Entry HPPC18_02680      CDS       T02036                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hca  Helicobacter pylori PeCan18 Pathway hca01100   Metabolic pathways hca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPPC18_02680 (acpP)    00074 Mycolic acid biosynthesis     HPPC18_02680 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPPC18_02680 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  AFI02309 UniProt:  I0EH90 LinkDB All DBs Position complement(556861..557097) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttaccccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactggcttaa

DBGET integrated database retrieval system