KEGG   Helicobacter pylori PeCan18: HPPC18_02785
Entry
HPPC18_02785      CDS       T02036                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00540  Lipopolysaccharide biosynthesis
hca01100  Metabolic pathways
Module
hca_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPPC18_02785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hca01005]
    HPPC18_02785
Lipopolysaccharide biosynthesis proteins [BR:hca01005]
 Lipid A
  HPPC18_02785
SSDB
Motif
Pfam: BNR_2 DUF3741 OppC_N
Other DBs
NCBI-ProteinID: AFI02330
UniProt: I0EHB1
LinkDB
Position
complement(574276..575394)
AA seq 372 aa
MEPSRNRLKNTAFFVGLFIVLFLIIMKCQPPPYAFTHNQTLVTQTPPYFTQLTIPKPNDA
LSAHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFILLTKEELSHH
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLVRNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNTLNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTDWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLNSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaaaacaccgcctttttcgtggggctttttatcgtt
ttatttttaattataatgaagtgccaaccccccccctatgctttcacgcataatcaaacc
cttgttactcaaacccccccctatttcacgcaactcactatccctaaaccaaatgacgct
ttaagtgcgcatgcgagctctttgatcagcttgcctaatgataatcttttgagcgcttat
ttcagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagactaatcgctggagcgaagccttcattcttttaaccaaagaagagctttctcatcat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatc
ttgttgtttgtggtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaaatttgcgcgaaaactctctttaagccctttt
ttaaacttgagccatttagtaaggaataaacctttaaacaccactgatggcggttttatg
ctaccactctatcacgaattagccacccaataccccctattattgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaataccctaaaccaccagctccaaccaagctta
accccctttaaagactgcgctgtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgcaaaacccccactgattggcaaaaacccatgctcacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatcactgcgtcgtaaagaactttggctttctaaattagaaaactccaac
tcgtttaaaaccttaaaagttttagataaagcgaatgaagtgagttacccaagctatagt
cttaatccgcattttatagatattgtctatacttacaaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaattcccttctcaagtaa

DBGET integrated database retrieval system