Halomonas sp. SS10-MC5: I4484_08950 Help Entry I4484_08950       CDS       T07024                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hcam  Halomonas sp. SS10-MC5 Pathway hcam01100   Metabolic pathways hcam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hcam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I4484_08950    00074 Mycolic acid biosynthesis     I4484_08950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I4484_08950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QPP51185 LinkDB All DBs Position 1896698..1896949 Genome browser AA seq 83 aa AA seqDB search MNREELRTIVLEELSAIAPDIDIDHFDDRARLRDEYDLDSMDALNLLTAVHQRLGVNIPE SDYARMQNLQALLDYLETRVENC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaacagagaagaattgcgtaccatcgtgctcgaggagctttccgccattgcgccggat atcgatatcgaccacttcgatgaccgtgcccggctgcgtgacgaatacgatctcgattcc atggatgccctcaacctgctaaccgctgtacaccagcgtctgggcgtcaacatcccagag agtgattacgcacggatgcagaacctccaagcgctgctggattatctggaaacgcgagtc gaaaactgttga

DBGET integrated database retrieval system