Halomonas sp. SS10-MC5: I4484_13440 Help Entry I4484_13440       CDS       T07024                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism hcam  Halomonas sp. SS10-MC5 Brite KEGG Orthology (KO) [BR:hcam00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hcam03036]     I4484_13440 (ftsL) Chromosome and associated proteins [BR:hcam03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     I4484_13440 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC TAP_C Motif Other DBs NCBI-ProteinID:  QPP51636 LinkDB All DBs Position complement(2888793..2889095) Genome browser AA seq 100 aa AA seqDB search MLRVARRPAWLPSWRLLLVLGLLLACLANATAVINASHQTRMQYVRLQQLERERDQLQTE WSQLLLEESAWSSPARIERLAVERLEMRLPDVDEVEVIRP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcgtcgccaggcgtccggcctggctgccgagctggcgcctgctgctcgtcctt ggcctgctgctggcctgcctggccaacgccacggcggtgatcaacgccagccaccagacc cgcatgcagtacgtgcgcctgcagcagctcgagcgtgagcgcgatcagctgcagacggag tggagccagctgctgctcgaggagagcgcctggtcatcaccggcgcgcatcgagcgcctg gccgtcgagcggctcgagatgcgcctccccgatgtcgacgaagtcgaggtcatacggcca tga

DBGET integrated database retrieval system