KEGG   Hymenobacter cellulosivorans: MUN80_15880
Entry
MUN80_15880       CDS       T09419                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
hcf  Hymenobacter cellulosivorans
Pathway
hcf02020  Two-component system
hcf02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MUN80_15880
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    MUN80_15880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hcf02022]
    MUN80_15880
   02035 Bacterial motility proteins [BR:hcf02035]
    MUN80_15880
Two-component system [BR:hcf02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   MUN80_15880
Bacterial motility proteins [BR:hcf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MUN80_15880
SSDB
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-ProteinID: UOQ51238
UniProt: A0ABY4F3X5
LinkDB
Position
3790219..3790617
AA seq 132 aa
MKNRILIVDDSFYMRTMLKNMLTDAGYEVVGEAANGQQALEMASATRPDLITLDVILPDN
TGLDVLKGIRMEQPDVKVVMCSAVGQEVIVNEALESGATAYIVKPFSEEKVLEIVGGALQ
NQDSNSADSTEA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaaaaaccgcattctcatcgtggacgactcattttatatgcgcacgatgctcaagaat
atgctcaccgacgccggctacgaggtagtcggtgaagctgccaacggtcagcaagccttg
gaaatggccagcgccacccgccctgatcttatcactctggacgtgattctgcccgataac
accggtttggacgtgctcaaaggtatccggatggaacagccggacgtcaaagtggtaatg
tgcagcgctgtaggccaggaggtaatcgtgaacgaagccctcgaaagcggcgctacggcc
tatatcgtgaagcctttttccgaggaaaaagtactggaaatcgttggtggtgccctgcag
aaccaagactccaattccgctgattctaccgaagcctaa

DBGET integrated database retrieval system