KEGG Orthology (KO) [BR:hcg00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
128329786 (ELOB)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:hcg04121]
128329786 (ELOB)
03400 DNA repair and recombination proteins [BR:hcg03400]
128329786 (ELOB)
Ubiquitin system [BR:hcg04121]
Ubiquitin ligases (E3)
Multi subunit type E3
Cul2 complex
Adoptor protein
128329786 (ELOB)
Cul5 complex
128329786 (ELOB)
DNA repair and recombination proteins [BR:hcg03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
Other NER factors
128329786 (ELOB)
176 aa
MVSFPSPERNPFLRRMRPSVAGRTGLGCPEVAVHVGISEVLLLFPLWGVWAEAAAAEMDV
FLMIRRHKTTIFTDAKESSTVYELKRIVEGILKRPPEEQRLYKDDQLLDDSKTLGDCGFT
SQTARPQAPATVGLAFRASEDAFEPLRIDPFSSPPELPDVMKPQDSSSSANEQAVQ