Hahella chejuensis: HCH_00919 Help Entry HCH_00919         CDS       T00307                                  Symbol atpE1 Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism hch  Hahella chejuensis Pathway hch00190   Oxidative phosphorylation hch01100   Metabolic pathways Module hch_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:hch00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HCH_00919 (atpE1)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:hch00194]     HCH_00919 (atpE1) Photosynthesis proteins [BR:hch00194]  Photosystem and electron transport system   F-type ATPase [OT]    HCH_00919 (atpE1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Virul_fac_BrkB DUF6198 YLP Motif Other DBs NCBI-ProteinID:  ABC27809 UniProt:  Q2SNG5 LinkDB All DBs Position complement(915964..916236) Genome browser AA seq 90 aa AA seqDB search METMNSFVSFSTVAAIIGIALGAMLPALAMGKAISSALDALARQPEAEKSITRTLFIGLA MIESLAIYVLVIVLIVLFRNPLLEYLPPAQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggagaccatgaacagttttgtatccttctcgaccgtcgccgcgattatcggcattgcg ttgggcgccatgctgccggcgctggccatgggcaaggcgatcagcagcgcgcttgatgcg ctggcgcgacaaccggaagcggaaaagtcgattacccgcacgctgttcatcggcttggcg atgattgaatccctggcgatctatgtgctggtcatcgtgctgatcgtcttgttccgcaat ccgcttttggagtacctgccgccagcgcaataa

DBGET integrated database retrieval system