KEGG   Hahella chejuensis: HCH_06036
Entry
HCH_06036         CDS       T00307                                 
Name
(GenBank) Nitroreductase
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
hch  Hahella chejuensis
Pathway
hch00333  Prodigiosin biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HCH_06036
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: ABC32686
UniProt: Q2S9I8
LinkDB
Position
6184122..6185249
AA seq 375 aa
MQSTFAQELQETVDLARWAPSSHNSQPWTLIHIQERERASALLGEALQEGEQCVVLALNS
ARKLKALESLEIEMLMSCGLFLGLFCMTLGVRGHDWRLRWFCEAEKSAPIAALEQEQGCL
ALTAVRITPNSVKPVADAEAWRRLALHRRTHRGPFNPLRISDETLQQLLARRWPLSLTGE
HLLMRIERDQPAIRRAAQLVKQYAVLDFANYKAWRETYRYIHFSLEEEAEDGFYLQSLLG
PQSKWSSLFYRCVLAPPVMQALRPFGAPQRMADQLGALVEDSSQLLFCHLGEEHMTPKAL
TQAGARLMEVWLNAQEQKLAIHPVSVMLQHDQARIAIERLRDENGRMIFFARLGAIKEVF
DKSPRRKTNGIIAAG
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcagtcgaccttcgctcaagaactgcaggaaaccgtggatttggcgcgctgggcgccg
tcatcccacaactcgcaaccctggacgttgatacatattcaggagcgcgagcgggccagc
gcactccttggagaagcgcttcaggagggagagcaatgcgtcgtcctggcgttgaacagc
gctcgcaaactcaaagccctggaaagtctggaaatcgaaatgctgatgagctgcggcttg
tttctgggcttgttttgcatgaccctgggggttcgcggccatgactggcgcctgcgctgg
ttctgtgaagcggaaaagagcgcgcccatcgccgcgctggagcaagagcaggggtgcctg
gcgctgaccgcagtgcgcattacgccgaacagcgttaagcccgtcgccgacgctgaagcg
tggcggcgactggcgctgcatagacgcactcaccgcggcccctttaaccctttacgcatc
agcgacgaaacgttgcagcaactactggccaggcgttggccgttgtccttaaccggggag
cacttgctgatgcggatagaacgcgatcagcctgcgattcgccgcgcggcgcaactggta
aaacagtatgcggtgctggacttcgccaactataaagcctggcgcgagacctatcgctac
atccacttttccctggaagaagaggcggaagacggattctatctgcaaagcctgctcggc
ccgcaaagcaagtggagcagtctgttctatcgttgcgtgctggctccgccggtcatgcag
gccctgcggcccttcggcgcgccgcaacgtatggcggatcagcttggcgcgctggtggaa
gattcatcccaattgttgttctgccatctcggagaggagcatatgacgccgaaagcgctg
actcaggccggcgcgcgcctgatggaggtctggctcaacgcccaggagcagaaactggcg
atacacccggtcagcgtcatgctgcagcatgaccaggcgcgcattgcgatcgagcgactg
cgggacgaaaacggacgcatgattttcttcgccaggcttggcgccatcaaagaagttttc
gacaaaagccccagaagaaaaaccaacggcatcatcgccgccggataa

DBGET integrated database retrieval system