Helicobacter cholecystus: NCTC13205_01296 Help Entry NCTC13205_01296   CDS       T06600                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hcl  Helicobacter cholecystus Pathway hcl01100   Metabolic pathways hcl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hcl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC13205_01296 (acpP)    00074 Mycolic acid biosynthesis     NCTC13205_01296 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC13205_01296 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  VEJ26073 LinkDB All DBs Position 1:complement(1329725..1329955) Genome browser AA seq 76 aa AA seqDB search MATFDDVKAIVVEQLGVSPDEVKMESKFVDDLNADSLDVVELIMELEEKLGVAIPDEDAE KITSVGDVVAYIDSKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctacatttgatgatgtaaaagcaattgttgttgaacaactcggagtaagtcctgat gaagtaaaaatggaatcaaaatttgttgatgatctcaatgctgactctcttgatgttgtt gaactaattatggagcttgaagaaaagcttggtgtagcaattccagatgaagatgcagaa aaaatcacatcagttggcgatgttgttgcttatatcgatagcaaaaaataa

DBGET integrated database retrieval system