KEGG   Helicobacter cetorum MIT 99-5656: HCD_01355
Entry
HCD_01355         CDS       T02033                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00540  Lipopolysaccharide biosynthesis
hcm01100  Metabolic pathways
Module
hcm_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hcm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HCD_01355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hcm01005]
    HCD_01355
Lipopolysaccharide biosynthesis proteins [BR:hcm01005]
 Lipid A
  HCD_01355
SSDB
Motif
Pfam: BNR_2 OppC_N
Other DBs
NCBI-ProteinID: AFI05303
UniProt: I0EQT4
LinkDB
Position
277228..278346
AA seq 372 aa
MEHSRNRLKNTAFFVGLAFVLFLILITHKSPPYAFTHNNTLSNESPPYFTQLNIPKPSNA
LSVHASSLISLPNGNLLSAYFSGSKEGARDVKISANLFDSKTNRWSEAFILLTKENLFKN
SHEFIKKLGNPLLFLHKDKILLFVVGVSMGGWATSKIYQFESPLTPIDFKFVRKLSLSPF
LNLSHLVRTKPLNTTDGGFMLPLYHELATQYPLLLKFDANNNPRELLRPNLLNHQLQPSL
TPFKDCAIMAFRNYSLKDNLMLQTCKTPTAWQKPIATNLKNLNDSLNLLNLNEALYLVHN
PSDLLLRRKELLLSKLEDSNTFQILKVLDKANEVSYPSSSVSSDFIDIVYTYNRSNIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaaaataccgccttttttgtagggcttgcttttgtg
ttatttttaattcttataacgcataaatctcccccctatgccttcactcataataatacc
ctttcaaatgaaagccccccctacttcacacagctaaatattcctaagccaagtaacgcc
ttaagcgtgcatgcaagctctttaattagcctgcctaatggcaatctcttgagtgcttat
tttagcggtagcaaagaaggggcaagagatgtgaaaattagtgctaatctttttgacagc
aaaactaatcgttggagtgaagcttttattcttttaaccaaagaaaatcttttcaaaaac
tcgcatgaatttatcaaaaaactaggcaatcccctactttttttacataaagataaaatt
ttgttgtttgtagtgggagttagcatgggcggatgggcaacttctaaaatctatcagttt
gaaagccctttaacgcctattgattttaagtttgtgcgtaaactttctttaagccctttc
ttaaacctaagccatttagtaaggactaagcccttaaacactactgatggcggatttatg
ctaccactctatcacgaattagccacccaataccccttgttgctaaaatttgatgcaaat
aataaccctagagaactcttaagacctaatttattgaatcatcagctccagccaagcctt
acaccctttaaagattgtgccataatggcgtttagaaattattctttaaaagataatctc
atgctacaaacttgtaaaacccccaccgcttggcaaaaacccattgcaacgaatttaaaa
aatctgaatgattctttgaatttactcaatttaaatgaagcgttgtatttagtccataat
cctagcgatttattgttacgccgaaaagaactcttgctttctaaactagaagattcaaac
acctttcaaatcttaaaagttttagacaaagctaatgaagtgagttatccaagctctagt
gttagctcagattttatagatattgtctatacctataaccgctcaaacatcaaacatatc
cgttttaatatggcttatttaaaatctcttctcaagtaa

DBGET integrated database retrieval system