KEGG   Helicobacter pylori HUP-B14: HPB14_03790
Entry
HPB14_03790       CDS       T02035                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00540  Lipopolysaccharide biosynthesis
hcn01100  Metabolic pathways
Module
hcn_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hcn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPB14_03790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hcn01005]
    HPB14_03790
Lipopolysaccharide biosynthesis proteins [BR:hcn01005]
 Lipid A
  HPB14_03790
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFI07457
UniProt: I0EWY8
LinkDB
Position
783939..785057
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVSFLIIMKRQTPPYAFTHNQTLVTQTPPYFTQLTIPKPNDA
LSAHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSETFTILTKEELSHH
SHEYIKKLGNPLLFLHDNKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLVRNKPLSTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPTLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLNSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
tcatttttaattataatgaagcgccaaacccccccctatgctttcacgcataatcaaacc
cttgttactcaaacccccccctatttcacgcaactcactatccctaaaccaaatgacgct
ttaagcgcgcatgcgagctctttaatcagcttgcctaacgacaatcttttgagcgcttat
ttcagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aaaactaatcgctggagcgaaaccttcactattttaaccaaagaagagctttctcatcat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatgataataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcgcgaaaactctctttaagccctttt
ttaaacttgagccatttagtaaggaataaacccttaagcaccactgatggcggttttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccacgagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagattgcgctattatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaaccccaaccgcttggcaaaaacccacgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatctttgcgtcgtaaagaactctggctttctaaattagaaaactccaac
tcgtttaaaaccttaaaagttttagacaaagccaatgaagtgagttacccaagctatagc
cttaatcctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaattcccttctcaagtaa

DBGET integrated database retrieval system